(data stored in ACNUC9435 zone)

EMBL: AM039951.PE125

AM039951.PE125       Location/Qualifiers
FT   CDS             135638..136363
FT                   /transl_table=11
FT                   /locus_tag="XCVd0125"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19937"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19937.1"
FT                   /translation="MTPLPQTIVQSHMLDIFCPLAEDIGNLADWAAVAVALFGAIAVFQ
FT                   LSRAANATARGVKRVAEREARDRRAAAAREGRLLLIYLENEFRQALTAFGTLATGLDVV
FT                   DHDSFIDSGYARAQFLSEADGISLKLSREMFHRLHVLVDKDAHDIARVVSGLSVLQQAA
FT                   AEAASIDLSETMPGVDGASWNEFRRETLSERFVLLRKGAAEMQVILIRLIQEAVAAKVV
FT                   AGAQHHTLENNARGPSTAG"
     MTPLPQTIVQ SHMLDIFCPL AEDIGNLADW AAVAVALFGA IAVFQLSRAA NATARGVKRV        60
     AEREARDRRA AAAREGRLLL IYLENEFRQA LTAFGTLATG LDVVDHDSFI DSGYARAQFL       120
     SEADGISLKL SREMFHRLHV LVDKDAHDIA RVVSGLSVLQ QAAAEAASID LSETMPGVDG       180
     ASWNEFRRET LSERFVLLRK GAAEMQVILI RLIQEAVAAK VVAGAQHHTL ENNARGPSTA       240
     G                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page