(data stored in ACNUC9435 zone)

EMBL: AM039951.PE128

AM039951.PE128       Location/Qualifiers
FT   CDS             complement(138454..138753)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0128"
FT                   /product="histone-like family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19940"
FT                   /db_xref="GOA:Q3BZX6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19940.1"
FT                   /translation="MNKSALASAIAHRHAMTQAEASSIVDTVTEVVALMLLEHGRVNIN
FT                   RFGRFRLQHKPPRQARNPKTGETVQVGERVAVQFTAADELKRRFLDSKNGNRLE"
     MNKSALASAI AHRHAMTQAE ASSIVDTVTE VVALMLLEHG RVNINRFGRF RLQHKPPRQA        60
     RNPKTGETVQ VGERVAVQFT AADELKRRFL DSKNGNRLE                               99
//

If you have problems or comments...

PBIL Back to PBIL home page