(data stored in ACNUC9435 zone)

EMBL: AM039951.PE130

AM039951.PE130       Location/Qualifiers
FT   CDS             139391..139768
FT                   /transl_table=11
FT                   /locus_tag="XCVd0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19942"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19942.1"
FT                   /translation="MVTALNALPVALVDSEAHAIWVHIRGRAAVKKSGQGAAFRRVVRA
FT                   DYAGRLRLHSNSPWRPFCPAAGDDQAIEVSLIRVGRILDKTEFDGPEWDRLQKHGLDAF
FT                   LIEAIATRSFRGAMRRIFGST"
     MVTALNALPV ALVDSEAHAI WVHIRGRAAV KKSGQGAAFR RVVRADYAGR LRLHSNSPWR        60
     PFCPAAGDDQ AIEVSLIRVG RILDKTEFDG PEWDRLQKHG LDAFLIEAIA TRSFRGAMRR       120
     IFGST                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page