(data stored in ACNUC9435 zone)

EMBL: AM039951.PE132

AM039951.PE132       Location/Qualifiers
FT   CDS             140849..141427
FT                   /transl_table=11
FT                   /locus_tag="XCVd0132"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19944"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZX2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19944.1"
FT                   /translation="MRDILLATCLILGAAAAPAHASENISLHVKVTNGSKVLVDTNLLT
FT                   TPGAPAQARVGSDIRYVSSTTVYSRGKRSSLGGKKGTPVDRPPAERTYATLFDGVDITV
FT                   YPEPLAEAVGSPDKVLLRTRVSLSRLNGMEHTGEGDARIDLPSVQNFRTQSNTVVAWGS
FT                   PQVISYKSAGDEAADDYRIEVTPSTAKAR"
     MRDILLATCL ILGAAAAPAH ASENISLHVK VTNGSKVLVD TNLLTTPGAP AQARVGSDIR        60
     YVSSTTVYSR GKRSSLGGKK GTPVDRPPAE RTYATLFDGV DITVYPEPLA EAVGSPDKVL       120
     LRTRVSLSRL NGMEHTGEGD ARIDLPSVQN FRTQSNTVVA WGSPQVISYK SAGDEAADDY       180
     RIEVTPSTAK AR                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page