(data stored in ACNUC9435 zone)

EMBL: AM039951.PE135

AM039951.PE135       Location/Qualifiers
FT   CDS             143593..143835
FT                   /transl_table=11
FT                   /locus_tag="XCVd0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19947"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19947.1"
FT                   /translation="MSALARLLDIPRAAPPHDLEHTLALLDDMRRQIDALGDISRNYGQ
FT                   LNHKLKQRKLQDIHLKLRDMRDDLAQRVVPSIKET"
     MSALARLLDI PRAAPPHDLE HTLALLDDMR RQIDALGDIS RNYGQLNHKL KQRKLQDIHL        60
     KLRDMRDDLA QRVVPSIKET                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page