(data stored in ACNUC9435 zone)

EMBL: AM039951.PE138

AM039951.PE138       Location/Qualifiers
FT   CDS             complement(145224..145910)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0138"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19950"
FT                   /db_xref="InterPro:IPR023089"
FT                   /db_xref="InterPro:IPR036806"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19950.1"
FT                   /translation="MANSLSPAQITRIKRQAKKLVRETSITHAEALDRSATAHGFANWS
FT                   LLSKACVAPGGRPELATKEAIRRAAIRYYLHGDQDEEDPSTYYCARCDSFCLPDHFEND
FT                   ALHRGQSHEMRYLESIERWSERGTVWRSRYRRPEDAPNLLAAKAVALNLAYQQSRSAFH
FT                   RWLLAQVDRDDIVSDLAVDVRADKTFPVGASSRQEIERYLARHGDHVLEALERAWLEFS
FT                   TAHGKG"
     MANSLSPAQI TRIKRQAKKL VRETSITHAE ALDRSATAHG FANWSLLSKA CVAPGGRPEL        60
     ATKEAIRRAA IRYYLHGDQD EEDPSTYYCA RCDSFCLPDH FENDALHRGQ SHEMRYLESI       120
     ERWSERGTVW RSRYRRPEDA PNLLAAKAVA LNLAYQQSRS AFHRWLLAQV DRDDIVSDLA       180
     VDVRADKTFP VGASSRQEIE RYLARHGDHV LEALERAWLE FSTAHGKG                    228
//

If you have problems or comments...

PBIL Back to PBIL home page