(data stored in ACNUC9435 zone)

EMBL: AM039951.PE139

AM039951.PE139       Location/Qualifiers
FT   CDS             146321..147313
FT                   /transl_table=11
FT                   /locus_tag="XCVd0139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19951"
FT                   /db_xref="InterPro:IPR022550"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19951.1"
FT                   /translation="MKFNMIVDEGLRLAANMETRYDAWLQASRAIADGRLQWKTSGGHD
FT                   YLYRIIDSKGNGTSLGPRSPATEAMMESFQNAKLTVQNTWATLEREGKMYRSLRLPRIA
FT                   SYGAQVLRELDISGLLGDSVLVVGTNALCAYALEAGQLLSSTLDATEDFDLTWVRDVSN
FT                   APPALQAPSVFGVLKSVDSTYTINTERPFQARNSHGNEVELLIAESLAGLPTYERLRPI
FT                   PLPEQNWLLPGTRISHITCGMDGLPARVVAPDPRWFALHKLWLADKESRNVLKKGKDRE
FT                   QGDTVLHLVNDHMPHFPLDDAFEDSLPDELRPYFEDWKQENGLTPPGMR"
     MKFNMIVDEG LRLAANMETR YDAWLQASRA IADGRLQWKT SGGHDYLYRI IDSKGNGTSL        60
     GPRSPATEAM MESFQNAKLT VQNTWATLER EGKMYRSLRL PRIASYGAQV LRELDISGLL       120
     GDSVLVVGTN ALCAYALEAG QLLSSTLDAT EDFDLTWVRD VSNAPPALQA PSVFGVLKSV       180
     DSTYTINTER PFQARNSHGN EVELLIAESL AGLPTYERLR PIPLPEQNWL LPGTRISHIT       240
     CGMDGLPARV VAPDPRWFAL HKLWLADKES RNVLKKGKDR EQGDTVLHLV NDHMPHFPLD       300
     DAFEDSLPDE LRPYFEDWKQ ENGLTPPGMR                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page