(data stored in ACNUC9435 zone)

EMBL: AM039951.PE142

AM039951.PE142       Location/Qualifiers
FT   CDS             complement(149763..150383)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0142"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19954"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19954.1"
FT                   /translation="MTPNTDPVDRHQARVYALSAALASVLPYALSRAEDLHDLHDNGEA
FT                   DSHTPDAHLKAAAAYEGAQQLLQEVSIEAASRGLSARDVGSRLAFALELYSMAPFIGQQ
FT                   YGEYALQTAREAVRKWRLGSAGEGTTDAALMALARPLRECLEDYLDLPGITSQYGQVNF
FT                   DHGAGAVDAYWTLRLAELTPPAAHELVCVAGGEEVEDSPRPGV"
     MTPNTDPVDR HQARVYALSA ALASVLPYAL SRAEDLHDLH DNGEADSHTP DAHLKAAAAY        60
     EGAQQLLQEV SIEAASRGLS ARDVGSRLAF ALELYSMAPF IGQQYGEYAL QTAREAVRKW       120
     RLGSAGEGTT DAALMALARP LRECLEDYLD LPGITSQYGQ VNFDHGAGAV DAYWTLRLAE       180
     LTPPAAHELV CVAGGEEVED SPRPGV                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page