(data stored in ACNUC9435 zone)

EMBL: AM039951.PE143

AM039951.PE143       Location/Qualifiers
FT   CDS             complement(150380..151387)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19955"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19955.1"
FT                   /translation="MMIRGLPYEGNVILPVVLLGEGNQVIPFRDVCYRDLWRSDLVSEV
FT                   DPSAPEQGHAAYYTVLLTSGGADSAYDVDIDVLDYRSAELVGELCDSLHRAEKALMRAT
FT                   ARSVDPDQRVMAIQTIEDCARAWLRCNRAVPVTVNAEGALTQQPLARPRQGLCVDELES
FT                   SSSTAFWQVRELLPQAVSSLMVNLVDREDAKMFDFLYEQLITVREFGLTLRPWVMGGAQ
FT                   GEPPLSRSFYEALNVDPQPWAIPAFDLKPEAWLVALRERGFDFDPASTSIEDDLVDLRN
FT                   EDGEAVVGRRLASRIAWSVDHFCARHNLTREDLQLVARETMPAAADAASMGMKQ"
     MMIRGLPYEG NVILPVVLLG EGNQVIPFRD VCYRDLWRSD LVSEVDPSAP EQGHAAYYTV        60
     LLTSGGADSA YDVDIDVLDY RSAELVGELC DSLHRAEKAL MRATARSVDP DQRVMAIQTI       120
     EDCARAWLRC NRAVPVTVNA EGALTQQPLA RPRQGLCVDE LESSSSTAFW QVRELLPQAV       180
     SSLMVNLVDR EDAKMFDFLY EQLITVREFG LTLRPWVMGG AQGEPPLSRS FYEALNVDPQ       240
     PWAIPAFDLK PEAWLVALRE RGFDFDPAST SIEDDLVDLR NEDGEAVVGR RLASRIAWSV       300
     DHFCARHNLT REDLQLVARE TMPAAADAAS MGMKQ                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page