(data stored in ACNUC9435 zone)

EMBL: AM039951.PE144

AM039951.PE144       Location/Qualifiers
FT   CDS             complement(151384..152028)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19956"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19956.1"
FT                   /translation="MRLTAASDSEQYIRSRPMKKQTLTYTKDPRYTVELDYTEGHPDDP
FT                   GAGTPAMVCGPNGTSGTFFCVRDTGWLNEGERNGHEVPPGVKQWLEEREDLVDGYVNAA
FT                   FAYASNHHRDAVSPADTEASPMIQEFTVASEGASLDEVEIVGASIDDDQFQFLLDTNGT
FT                   VYARDQNGVVMELSFDMDGESLVALPMKETATGLEQMSDDEWREHVPRMSP"
     MRLTAASDSE QYIRSRPMKK QTLTYTKDPR YTVELDYTEG HPDDPGAGTP AMVCGPNGTS        60
     GTFFCVRDTG WLNEGERNGH EVPPGVKQWL EEREDLVDGY VNAAFAYASN HHRDAVSPAD       120
     TEASPMIQEF TVASEGASLD EVEIVGASID DDQFQFLLDT NGTVYARDQN GVVMELSFDM       180
     DGESLVALPM KETATGLEQM SDDEWREHVP RMSP                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page