(data stored in ACNUC9435 zone)

EMBL: AM039951.PE146

AM039951.PE146       Location/Qualifiers
FT   CDS             complement(153499..153903)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0146"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19958"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19958.1"
FT                   /translation="MSVRRMVRAPISASTRDDLRRNCNTTQAVVETAARASKILEPRDA
FT                   YKEFRAAQDHFEVGCWLVYYRQQMAGEGAHEAIYECAELLRRHGLQEPTRNFETVFGFG
FT                   IDCYWSVVASQPRGRGAGEVCQMQPEVRAC"
     MSVRRMVRAP ISASTRDDLR RNCNTTQAVV ETAARASKIL EPRDAYKEFR AAQDHFEVGC        60
     WLVYYRQQMA GEGAHEAIYE CAELLRRHGL QEPTRNFETV FGFGIDCYWS VVASQPRGRG       120
     AGEVCQMQPE VRAC                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page