(data stored in ACNUC9435 zone)

EMBL: AM039951.PE147

AM039951.PE147       Location/Qualifiers
FT   CDS             complement(153900..154697)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19959"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19959.1"
FT                   /translation="MDNNLQPLYVSEAERQVMAAALSDFARTGQVTRDRAVDAGNHELA
FT                   VSLTTQLDAAAAALVRLQSAAPKAEAVDLGDRLKLHGTAAGLLGGSLAESPLWARSRHS
FT                   QLPASEGTQWETDRRGVAELVVGHLKEMMADLPAPAGHQWKLYERHELTWYMGGPGNSV
FT                   SAFLEPLNMHGKRADQSHGEVRVFLDEPRATIFLGTGPMVEGQHRSVFADGAAHTSGKS
FT                   YAETLLVAKTLIASSMAINQHVATLQASAAAEPEDEYEGAFKP"
     MDNNLQPLYV SEAERQVMAA ALSDFARTGQ VTRDRAVDAG NHELAVSLTT QLDAAAAALV        60
     RLQSAAPKAE AVDLGDRLKL HGTAAGLLGG SLAESPLWAR SRHSQLPASE GTQWETDRRG       120
     VAELVVGHLK EMMADLPAPA GHQWKLYERH ELTWYMGGPG NSVSAFLEPL NMHGKRADQS       180
     HGEVRVFLDE PRATIFLGTG PMVEGQHRSV FADGAAHTSG KSYAETLLVA KTLIASSMAI       240
     NQHVATLQAS AAAEPEDEYE GAFKP                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page