(data stored in ACNUC9435 zone)

EMBL: AM039951.PE148

AM039951.PE148       Location/Qualifiers
FT   CDS             complement(154705..155046)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19960"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19960.1"
FT                   /translation="MNVVKKPSIHYTLVSVDGCERTTSYCPASEGYRDYHDSGWTPREP
FT                   EQHTARAELEIDWGGGRHQMLKLEGHQHRDIEMYDKLPELLEAIGSGDQPETALQDALT
FT                   VESRPAMAG"
     MNVVKKPSIH YTLVSVDGCE RTTSYCPASE GYRDYHDSGW TPREPEQHTA RAELEIDWGG        60
     GRHQMLKLEG HQHRDIEMYD KLPELLEAIG SGDQPETALQ DALTVESRPA MAG              113
//

If you have problems or comments...

PBIL Back to PBIL home page