(data stored in ACNUC9435 zone)

EMBL: AM039951.PE149

AM039951.PE149       Location/Qualifiers
FT   CDS             complement(155461..155757)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0149"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19961"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19961.1"
FT                   /translation="MLIEVKVSRADFLADARKEHRIKPALGAGKWRYFMCPEGLINVDE
FT                   VSERWGLLWVSDKGTGWRRAAVMTGCSLRGRMRKSVVRMSLVQRASWIRRFAC"
     MLIEVKVSRA DFLADARKEH RIKPALGAGK WRYFMCPEGL INVDEVSERW GLLWVSDKGT        60
     GWRRAAVMTG CSLRGRMRKS VVRMSLVQRA SWIRRFAC                                98
//

If you have problems or comments...

PBIL Back to PBIL home page