(data stored in ACNUC9435 zone)

EMBL: AM039951.PE150

AM039951.PE150       Location/Qualifiers
FT   CDS             complement(156028..156768)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19962"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19962.1"
FT                   /translation="MKRQPSMALAVVPVFQPVIDLLNGEALYFEALARSTSKRSHGELL
FT                   SFAETYGFIELVDLAMLDQATEFLARSPGIRIGVNASVSTIERNCGPLVAAVFMHLQEA
FT                   DRLVVEITESIAVTNPRVVHSFIAGVRAAGAKVAFDDFGDGCFSFEDIVRFNPDIVKLA
FT                   GVMLGRRSEYSRDISRVLALAEGQGFIVVAENIDTEEKRQACIDMGIRYGQGFLLGELA
FT                   STPIRTTAPASLDTRRDTRVSVKS"
     MKRQPSMALA VVPVFQPVID LLNGEALYFE ALARSTSKRS HGELLSFAET YGFIELVDLA        60
     MLDQATEFLA RSPGIRIGVN ASVSTIERNC GPLVAAVFMH LQEADRLVVE ITESIAVTNP       120
     RVVHSFIAGV RAAGAKVAFD DFGDGCFSFE DIVRFNPDIV KLAGVMLGRR SEYSRDISRV       180
     LALAEGQGFI VVAENIDTEE KRQACIDMGI RYGQGFLLGE LASTPIRTTA PASLDTRRDT       240
     RVSVKS                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page