(data stored in ACNUC9435 zone)

EMBL: AM039951.PE153

AM039951.PE153       Location/Qualifiers
FT   CDS             159287..159685
FT                   /transl_table=11
FT                   /locus_tag="XCVd0153"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19965"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19965.1"
FT                   /translation="MTTTGRTKAKPVKSAAVRKGSATTTTARKSAPAKASTPAKTPPPA
FT                   QEVAGKSVVSPRSAEMKEARRFALTHNFGLSSRIRDLLDSKRPVLQIFIDENLPLAKVQ
FT                   EFIQRKYGPKIPAKALSTYLEANFKAKK"
     MTTTGRTKAK PVKSAAVRKG SATTTTARKS APAKASTPAK TPPPAQEVAG KSVVSPRSAE        60
     MKEARRFALT HNFGLSSRIR DLLDSKRPVL QIFIDENLPL AKVQEFIQRK YGPKIPAKAL       120
     STYLEANFKA KK                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page