(data stored in ACNUC9435 zone)

EMBL: AM039951.PE155

AM039951.PE155       Location/Qualifiers
FT   CDS             complement(160051..165309)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0155"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19967"
FT                   /db_xref="GOA:Q3BZU9"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR026741"
FT                   /db_xref="InterPro:IPR026937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039187"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19967.1"
FT                   /translation="MRSSMDANTLVRWVRLDPANPRVRLVGAQFPSGTRKLVLLGGDQV
FT                   APSTLSALAQLGFYQSPRGLVLRDELKFTLGELRRAFPGAEPVEVPVGRVVRALPRRAN
FT                   AGDPVNSGDLQANNIIGAIRELGCNSAGETVFESELGRFARRDHEVVGRESELAGATGA
FT                   SRFLRAPDAVELAGCADGFVVEMRRGKPMRYADLRRWAAVVNDAAEEQVETSPLLRVWQ
FT                   EAVEAALVRTLGAHGAADVPAFELARRLEEGQPPFKARTTSSIVNQQYSTTLPLAVAVQ
FT                   HIAGDQRGKLLLEPTIGNASLVSLIRDATIHSVDIDPARVASVRRDRPDIVVSVGDFLA
FT                   DPPPSPATDGKFDTVLCNPPFGGLARPVMVDRLKVGRLDHLVLVNSLRLRRDDGLAVYI
FT                   VGGDNALDSKAGEVRGGSRYLFNWLADHYQVDVVEVDGGLYAKQGAGFPVRLVVIGAKG
FT                   ASASPIPERLDVLQDHESVIAWARNMRARYAQAPAPALLLKQVAVESTPAFDASHLDVS
FT                   SNRIVLSEATPEPMFDAMDLDLPADSIEAAVHTAQASTDHANPLPPGGEEDSAANVSAV
FT                   DENSYQSPYIAQSRVGEASAMIPRNLQTATRSALERIVDEHGDIDEFVAKNLHWRVDEM
FT                   REREYLSPEQVDAVALCIYAEQYGRGCLEGDQTGLGKGRVMAAMARYAVLRGRQTVFLT
FT                   ETPTLFTDFWRDVQDIGSADLFKPMIVNDGVPVYDPKSGETLVPATPRSTLQRALAEDA
FT                   IPSEFNLVLATYSQFNRNANTSAKARWISGAARDSQLLLDEAHNAAGDSNTGRNIAAAI
FT                   EASRSVTYSSATSMKGAKNVLIYSALFPQSVDVAGLPETLQTGGEVLQEVLSGMMARDG
FT                   VFIRREHDLSALTFDTVADSTRLERNIELSDKLAEILELMNFVSGDINVMVSERNKEIE
FT                   KLRELIPEQERKGARMGAISMNFGSRLFSIYRQFQMAIKTELAIDRAIAALEAGKKPVI
FT                   VLENTMESLLRDVITNSRADGFEDLDQELANAAAAVNAEQDLAAGVDLGQDIVFADVLR
FT                   RMLDKLRYYSETTGYGEVVRRDVTSKETLKLIASIESLIGEFPDLPASPLDQIRTRLEE
FT                   AGYAADELSGRSLRIERRTDGVTGEAKSVATVRPERPKARIVREFNMGETDALLLTRAG
FT                   STGISLHASEKFDDQRQRVLIELQSAADVNVRVQFFGRVNRKGQVSSPEVETLSSGLIG
FT                   EARPIAMQNAKMRKLSANTTANQDSAALDRNVPDFINVVGDQVARRYLESNPLIAHRLD
FT                   IDLDIEGDDSGFQQEAYFITKLTSRLVMLRNAEQEAIYEEITSEYTRIIKELDEKGLNP
FT                   FKSKDLDLRATEDSRIVFEGGNAQSGSVFEQPVFLKTISYTEEVLPLRPMDVKARCDRT
FT                   EARFDSAYGHPLARVLTRMAGSLERLAPKLLQEGAQGRKESVDELLAATEVNAVKRLRD
FT                   RIDFIARTLPRCAPGALTTFSGAENARTEGVMVDITLPNNEKKMHNPGQYTVLIAVPGQ
FT                   SQLVERSLYALMEDPAFSTRPVGSPASGLWEAFDAAPAGLITRTRCVLDGNLFKAAQMA
FT                   AANKIGSCVMYTDQHGARHRGVMLNAGIRPDHINSLRVRIETPSVASWLIQEHPDIQLS
FT                   TNSQGEYELDRHAAIERDGPLLKMTVPGTKAWGGKYFSSEPLCELTGEFAGTRAYMVAR
FT                   FSPDKLPEVLRILTSIGVSMYGPSEVRAAINDFILGKYGYTNDCDAGHPAFSLAG"
     MRSSMDANTL VRWVRLDPAN PRVRLVGAQF PSGTRKLVLL GGDQVAPSTL SALAQLGFYQ        60
     SPRGLVLRDE LKFTLGELRR AFPGAEPVEV PVGRVVRALP RRANAGDPVN SGDLQANNII       120
     GAIRELGCNS AGETVFESEL GRFARRDHEV VGRESELAGA TGASRFLRAP DAVELAGCAD       180
     GFVVEMRRGK PMRYADLRRW AAVVNDAAEE QVETSPLLRV WQEAVEAALV RTLGAHGAAD       240
     VPAFELARRL EEGQPPFKAR TTSSIVNQQY STTLPLAVAV QHIAGDQRGK LLLEPTIGNA       300
     SLVSLIRDAT IHSVDIDPAR VASVRRDRPD IVVSVGDFLA DPPPSPATDG KFDTVLCNPP       360
     FGGLARPVMV DRLKVGRLDH LVLVNSLRLR RDDGLAVYIV GGDNALDSKA GEVRGGSRYL       420
     FNWLADHYQV DVVEVDGGLY AKQGAGFPVR LVVIGAKGAS ASPIPERLDV LQDHESVIAW       480
     ARNMRARYAQ APAPALLLKQ VAVESTPAFD ASHLDVSSNR IVLSEATPEP MFDAMDLDLP       540
     ADSIEAAVHT AQASTDHANP LPPGGEEDSA ANVSAVDENS YQSPYIAQSR VGEASAMIPR       600
     NLQTATRSAL ERIVDEHGDI DEFVAKNLHW RVDEMREREY LSPEQVDAVA LCIYAEQYGR       660
     GCLEGDQTGL GKGRVMAAMA RYAVLRGRQT VFLTETPTLF TDFWRDVQDI GSADLFKPMI       720
     VNDGVPVYDP KSGETLVPAT PRSTLQRALA EDAIPSEFNL VLATYSQFNR NANTSAKARW       780
     ISGAARDSQL LLDEAHNAAG DSNTGRNIAA AIEASRSVTY SSATSMKGAK NVLIYSALFP       840
     QSVDVAGLPE TLQTGGEVLQ EVLSGMMARD GVFIRREHDL SALTFDTVAD STRLERNIEL       900
     SDKLAEILEL MNFVSGDINV MVSERNKEIE KLRELIPEQE RKGARMGAIS MNFGSRLFSI       960
     YRQFQMAIKT ELAIDRAIAA LEAGKKPVIV LENTMESLLR DVITNSRADG FEDLDQELAN      1020
     AAAAVNAEQD LAAGVDLGQD IVFADVLRRM LDKLRYYSET TGYGEVVRRD VTSKETLKLI      1080
     ASIESLIGEF PDLPASPLDQ IRTRLEEAGY AADELSGRSL RIERRTDGVT GEAKSVATVR      1140
     PERPKARIVR EFNMGETDAL LLTRAGSTGI SLHASEKFDD QRQRVLIELQ SAADVNVRVQ      1200
     FFGRVNRKGQ VSSPEVETLS SGLIGEARPI AMQNAKMRKL SANTTANQDS AALDRNVPDF      1260
     INVVGDQVAR RYLESNPLIA HRLDIDLDIE GDDSGFQQEA YFITKLTSRL VMLRNAEQEA      1320
     IYEEITSEYT RIIKELDEKG LNPFKSKDLD LRATEDSRIV FEGGNAQSGS VFEQPVFLKT      1380
     ISYTEEVLPL RPMDVKARCD RTEARFDSAY GHPLARVLTR MAGSLERLAP KLLQEGAQGR      1440
     KESVDELLAA TEVNAVKRLR DRIDFIARTL PRCAPGALTT FSGAENARTE GVMVDITLPN      1500
     NEKKMHNPGQ YTVLIAVPGQ SQLVERSLYA LMEDPAFSTR PVGSPASGLW EAFDAAPAGL      1560
     ITRTRCVLDG NLFKAAQMAA ANKIGSCVMY TDQHGARHRG VMLNAGIRPD HINSLRVRIE      1620
     TPSVASWLIQ EHPDIQLSTN SQGEYELDRH AAIERDGPLL KMTVPGTKAW GGKYFSSEPL      1680
     CELTGEFAGT RAYMVARFSP DKLPEVLRIL TSIGVSMYGP SEVRAAINDF ILGKYGYTND      1740
     CDAGHPAFSL AG                                                          1752
//

If you have problems or comments...

PBIL Back to PBIL home page