(data stored in ACNUC9435 zone)

EMBL: AM039951.PE156

AM039951.PE156       Location/Qualifiers
FT   CDS             complement(165376..166632)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19968"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19968.1"
FT                   /translation="MSALRSLRESAAPKGGGRTPNTFAAVLQVSTAVVEKVGDKESLKL
FT                   TGIVLNEVPGAGRDLPVAVEFRGDDAERAVSNFVKGHGGSRKIFDKPENAAGSVLTLES
FT                   CYLTDQMSDDDRMVVSSRWVNTLQKVNEATHSDRSFLEGVMATSPRVSFENPNYREGNE
FT                   EPRTITIPVSQEKFTARVQTEHGTFSREFDRAWGIERLNKLSKDAKPSVFIDTVEPNNA
FT                   KLVTSEEELRAALTEQLGRGTRALALLRVTDGEEVIDRLVYGQYKREGDEYLPDPAATL
FT                   EELFKNNVFRDIANTDLLAGLADGTLKIDSIPGYRLSYAGNPLKDDNAAYKLVSDLKAN
FT                   KVTRYEIAFGKEPNRFASVVLPGVARNDTIAGFSPINVIADRPGRHAAHEIATAHIDAK
FT                   AQAAVAPEPEDEPADSPAP"
     MSALRSLRES AAPKGGGRTP NTFAAVLQVS TAVVEKVGDK ESLKLTGIVL NEVPGAGRDL        60
     PVAVEFRGDD AERAVSNFVK GHGGSRKIFD KPENAAGSVL TLESCYLTDQ MSDDDRMVVS       120
     SRWVNTLQKV NEATHSDRSF LEGVMATSPR VSFENPNYRE GNEEPRTITI PVSQEKFTAR       180
     VQTEHGTFSR EFDRAWGIER LNKLSKDAKP SVFIDTVEPN NAKLVTSEEE LRAALTEQLG       240
     RGTRALALLR VTDGEEVIDR LVYGQYKREG DEYLPDPAAT LEELFKNNVF RDIANTDLLA       300
     GLADGTLKID SIPGYRLSYA GNPLKDDNAA YKLVSDLKAN KVTRYEIAFG KEPNRFASVV       360
     LPGVARNDTI AGFSPINVIA DRPGRHAAHE IATAHIDAKA QAAVAPEPED EPADSPAP         418
//

If you have problems or comments...

PBIL Back to PBIL home page