(data stored in ACNUC9435 zone)

EMBL: AM039951.PE157

AM039951.PE157       Location/Qualifiers
FT   CDS             complement(166833..167162)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19969"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19969.1"
FT                   /translation="MMPAHGQSCTVQLGVPVGAAAEAKDLASAVWAHAAPAFGGQTSVR
FT                   EALERLRADPMRTRDIGFALRLADEVAPSPAAAHTAPLVLRNLVAELAGLTTVEEHKQL
FT                   AASWQ"
     MMPAHGQSCT VQLGVPVGAA AEAKDLASAV WAHAAPAFGG QTSVREALER LRADPMRTRD        60
     IGFALRLADE VAPSPAAAHT APLVLRNLVA ELAGLTTVEE HKQLAASWQ                   109
//

If you have problems or comments...

PBIL Back to PBIL home page