(data stored in ACNUC9435 zone)

EMBL: AM039951.PE158

AM039951.PE158       Location/Qualifiers
FT   CDS             complement(167159..167962)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19970"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19970.1"
FT                   /translation="MSKTKISVSGLAHLLAQLLGYDIYTLSRAANIPRANVASWLGGNI
FT                   RGLRVNTIVELMGMLGLRLDAGAWRLDSQRVHFWRVKLGAFTKVEDALAAVELLSRLLG
FT                   ANSAITQVHPPKAVRGRSGLARTDQYMIGGGQCRVVVSVTQPFFRKVRVTPDVAKGTMW
FT                   RDDNRHHTMQIQASHWRQVLARDMTVKEFDQAFEQSMGAMDWGDLALAARQFNLTPEDL
FT                   LGWVRERYEPDTGSQAAADDIEVAGSQNVILLGRDIAPRRTGSYG"
     MSKTKISVSG LAHLLAQLLG YDIYTLSRAA NIPRANVASW LGGNIRGLRV NTIVELMGML        60
     GLRLDAGAWR LDSQRVHFWR VKLGAFTKVE DALAAVELLS RLLGANSAIT QVHPPKAVRG       120
     RSGLARTDQY MIGGGQCRVV VSVTQPFFRK VRVTPDVAKG TMWRDDNRHH TMQIQASHWR       180
     QVLARDMTVK EFDQAFEQSM GAMDWGDLAL AARQFNLTPE DLLGWVRERY EPDTGSQAAA       240
     DDIEVAGSQN VILLGRDIAP RRTGSYG                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page