(data stored in ACNUC9435 zone)

EMBL: AM039951.PE159

AM039951.PE159       Location/Qualifiers
FT   CDS             complement(168022..168681)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0159"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19971"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19971.1"
FT                   /translation="MTTKVANDEAESAMRSRMAAALGFVVGTQRWQGVSLQKVAVEAET
FT                   HRSNLSSFIRSHGGRRNISDVKLRAVLFALGLHWDLTLTRSLHRWDLGAEDHLMGGLRV
FT                   LLDVMGRYSVGVVTTAGCRESFFLLIADGGAVAMLRATGEVASGVAKLLGVDRILVDSD
FT                   RAVSEAVQRIWLTQDVAVAEKMVRGLMDSCGVAEVGIGRRDEAIREHESRQLIATA"
     MTTKVANDEA ESAMRSRMAA ALGFVVGTQR WQGVSLQKVA VEAETHRSNL SSFIRSHGGR        60
     RNISDVKLRA VLFALGLHWD LTLTRSLHRW DLGAEDHLMG GLRVLLDVMG RYSVGVVTTA       120
     GCRESFFLLI ADGGAVAMLR ATGEVASGVA KLLGVDRILV DSDRAVSEAV QRIWLTQDVA       180
     VAEKMVRGLM DSCGVAEVGI GRRDEAIREH ESRQLIATA                              219
//

If you have problems or comments...

PBIL Back to PBIL home page