(data stored in ACNUC9435 zone)

EMBL: AM039951.PE160

AM039951.PE160       Location/Qualifiers
FT   CDS             complement(168678..169250)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19972"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19972.1"
FT                   /translation="MALVVHGDGCMTNLHAMRRKVHADSLKPRNIELVPATGALGIQFE
FT                   RGSNRGGGFRRCGVVHMAIPSEWTLNLTSGQPSAEVFDPVARRAQGDESIEALQQQAFV
FT                   ERPHLVAFHRMLVSLTAADLASAARGGRDQRLEAGPGGHTYIAADVLVPAAGRDQFDAE
FT                   AWLSGHGHGLLRCSRKCTIIVRSKACK"
     MALVVHGDGC MTNLHAMRRK VHADSLKPRN IELVPATGAL GIQFERGSNR GGGFRRCGVV        60
     HMAIPSEWTL NLTSGQPSAE VFDPVARRAQ GDESIEALQQ QAFVERPHLV AFHRMLVSLT       120
     AADLASAARG GRDQRLEAGP GGHTYIAADV LVPAAGRDQF DAEAWLSGHG HGLLRCSRKC       180
     TIIVRSKACK                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page