(data stored in ACNUC9435 zone)

EMBL: AM039951.PE161

AM039951.PE161       Location/Qualifiers
FT   CDS             complement(169241..169597)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0161"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19973"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19973.1"
FT                   /translation="MLALINMAGVFGAAQAQVVNRLTPPQLEPAAAASTPTQAASRAPV
FT                   TEYAPISPPAASVLTVVSPLQDQIAAELAFLPNETNDEYTERMRTRYDQVKKNAQRVDA
FT                   EHAARMRALVQAWR"
     MLALINMAGV FGAAQAQVVN RLTPPQLEPA AAASTPTQAA SRAPVTEYAP ISPPAASVLT        60
     VVSPLQDQIA AELAFLPNET NDEYTERMRT RYDQVKKNAQ RVDAEHAARM RALVQAWR         118
//

If you have problems or comments...

PBIL Back to PBIL home page