(data stored in ACNUC9435 zone)

EMBL: AM039951.PE163

AM039951.PE163       Location/Qualifiers
FT   CDS             complement(172923..174167)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19975"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZU1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19975.1"
FT                   /translation="MGAKYFGSVRFDIDDPNAGGWASVEGGEAFRIANASSLDSSTVWW
FT                   TNLSFDSMWKANIHRLPNVKRTTYMHSWRRGDGQDAFCESWGLVRRRYTEKTIAEALSA
FT                   IFAQVMRVAARRYNVDLSQREVFPYDTLADEIRSRLLPVADPSLGPEADGAIGESHLYY
FT                   NTCMTPHHRTEDYVDVCFSKPAVAYAREMTQTIIPSDQVEYLDQQSLPPFGKRLDWVLN
FT                   DPRPVLARVSVADVHPDFANLISYGNGGRAGTNRNWLTQPEILLLSNFARVEIESAYVF
FT                   SEYRQMPSQCLLPDDITDLQAMTPNTQILATNHWIGLCRENPYRLEPGKSSERRTSPRA
FT                   AWLTSVDRFQMFTNALSLHQAGFTVCYYGAGVVVARVPKYNYRDAYEVAVSAGMLAPTT
FT                   MSEDIDVQEDLQDVG"
     MGAKYFGSVR FDIDDPNAGG WASVEGGEAF RIANASSLDS STVWWTNLSF DSMWKANIHR        60
     LPNVKRTTYM HSWRRGDGQD AFCESWGLVR RRYTEKTIAE ALSAIFAQVM RVAARRYNVD       120
     LSQREVFPYD TLADEIRSRL LPVADPSLGP EADGAIGESH LYYNTCMTPH HRTEDYVDVC       180
     FSKPAVAYAR EMTQTIIPSD QVEYLDQQSL PPFGKRLDWV LNDPRPVLAR VSVADVHPDF       240
     ANLISYGNGG RAGTNRNWLT QPEILLLSNF ARVEIESAYV FSEYRQMPSQ CLLPDDITDL       300
     QAMTPNTQIL ATNHWIGLCR ENPYRLEPGK SSERRTSPRA AWLTSVDRFQ MFTNALSLHQ       360
     AGFTVCYYGA GVVVARVPKY NYRDAYEVAV SAGMLAPTTM SEDIDVQEDL QDVG             414
//

If you have problems or comments...

PBIL Back to PBIL home page