(data stored in ACNUC9435 zone)

EMBL: AM039951.PE165

AM039951.PE165       Location/Qualifiers
FT   CDS             complement(174921..175325)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0165"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19977"
FT                   /db_xref="GOA:Q3BZT9"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19977.1"
FT                   /translation="MMIRNKRTWLAMATLLLVCLSLLTPFGAFAQDQMSGAPDVKTIAQ
FT                   NGTETANGVFTLIQSLVCLVGFIIVCIGVYGFYRVNKEKGQGQASIATSFVGCIVGVLM
FT                   VMLPLTVGTLGKTVFGDQAGRPQRINITPQ"
     MMIRNKRTWL AMATLLLVCL SLLTPFGAFA QDQMSGAPDV KTIAQNGTET ANGVFTLIQS        60
     LVCLVGFIIV CIGVYGFYRV NKEKGQGQAS IATSFVGCIV GVLMVMLPLT VGTLGKTVFG       120
     DQAGRPQRIN ITPQ                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page