(data stored in ACNUC9435 zone)

EMBL: AM039951.PE171

AM039951.PE171       Location/Qualifiers
FT   CDS             complement(180223..180744)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19983"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19983.1"
FT                   /translation="MQPVHPDNHVFTVAGRVAGLGDQKGAYVIATSPEELVARFRDWDF
FT                   EVTSIASLADVRQSVEILDAIASCSAEVGAEEYLDLFPVEPGQRRQSSNVFTFVGKYVG
FT                   GGRVSEATAMAGFGTAADASALSGYLRSAGFDVLSVMSHSEALDLQAEMRLVACDALAD
FT                   EAHLVNLKEL"
     MQPVHPDNHV FTVAGRVAGL GDQKGAYVIA TSPEELVARF RDWDFEVTSI ASLADVRQSV        60
     EILDAIASCS AEVGAEEYLD LFPVEPGQRR QSSNVFTFVG KYVGGGRVSE ATAMAGFGTA       120
     ADASALSGYL RSAGFDVLSV MSHSEALDLQ AEMRLVACDA LADEAHLVNL KEL              173
//

If you have problems or comments...

PBIL Back to PBIL home page