(data stored in ACNUC9435 zone)

EMBL: AM039951.PE172

AM039951.PE172       Location/Qualifiers
FT   CDS             complement(181061..182371)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0172"
FT                   /product="putative replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19984"
FT                   /db_xref="GOA:Q3BZT2"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q3BZT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19984.1"
FT                   /translation="MTALAKPASHSKQSHQDRNECDKAPANMIVRKHVGAIQIFNSLTL
FT                   LQRKVFAALLLNGYDELPNFSIISHQIPIGVLSYLAGFNSKNTPYLKESLTGLVTSPVQ
FT                   WNILRSDGRAAWAVSATLASARIEDGVVYYSFSPELRKRLYDPEVSGVLSASVTRLMKS
FT                   SPALALYENCMVYAEEGVTPAFALPDLKGLLGVAGNSTYDDFGKFKDKVLNPACREVNR
FT                   VAPIQLEPILNRSARKVVSVAFAIKILGDGGSDKMREQADPFHGRDTDLVTRLQEEMTL
FT                   GYGSVVKLFEQHSDERLRAVRDYVVARFQEGKVQKHKLAPYFLRVAENATPESLSQKQT
FT                   TLTLEARKPASEKPKDEATLAAESAEAERRLQLQARLHTAEARLDALDSEQRAKLEESF
FT                   RQQLAADNKLIYDSLRKHEFSGPLYRKLLIQHVAAND"
     MTALAKPASH SKQSHQDRNE CDKAPANMIV RKHVGAIQIF NSLTLLQRKV FAALLLNGYD        60
     ELPNFSIISH QIPIGVLSYL AGFNSKNTPY LKESLTGLVT SPVQWNILRS DGRAAWAVSA       120
     TLASARIEDG VVYYSFSPEL RKRLYDPEVS GVLSASVTRL MKSSPALALY ENCMVYAEEG       180
     VTPAFALPDL KGLLGVAGNS TYDDFGKFKD KVLNPACREV NRVAPIQLEP ILNRSARKVV       240
     SVAFAIKILG DGGSDKMREQ ADPFHGRDTD LVTRLQEEMT LGYGSVVKLF EQHSDERLRA       300
     VRDYVVARFQ EGKVQKHKLA PYFLRVAENA TPESLSQKQT TLTLEARKPA SEKPKDEATL       360
     AAESAEAERR LQLQARLHTA EARLDALDSE QRAKLEESFR QQLAADNKLI YDSLRKHEFS       420
     GPLYRKLLIQ HVAAND                                                       436
//

If you have problems or comments...

PBIL Back to PBIL home page