(data stored in ACNUC9435 zone)

EMBL: AM039951.PE18

AM039951.PE18        Location/Qualifiers
FT   CDS             22121..22471
FT                   /transl_table=11
FT                   /locus_tag="XCVd0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19830"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C086"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19830.1"
FT                   /translation="MSLNDFIDGQLVNNTFNRRAVAETANNRDEWMAEAKRLRRELEAT
FT                   IADRDTWKAHGTASIELVRDLRENLAQSSPANPFADRNRLNERLKARKVELVQQMGYRV
FT                   INADADNFTITR"
     MSLNDFIDGQ LVNNTFNRRA VAETANNRDE WMAEAKRLRR ELEATIADRD TWKAHGTASI        60
     ELVRDLRENL AQSSPANPFA DRNRLNERLK ARKVELVQQM GYRVINADAD NFTITR           116
//

If you have problems or comments...

PBIL Back to PBIL home page