(data stored in ACNUC9435 zone)

EMBL: AM039951.PE19

AM039951.PE19        Location/Qualifiers
FT   CDS             22586..23095
FT                   /transl_table=11
FT                   /locus_tag="XCVd0019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19831"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C085"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19831.1"
FT                   /translation="MTWRTPSSLKWLIVKHSRLQGEIELLRREAEELDTQVVAQRQRLE
FT                   RAEKNLLAIETSLGMHEVQVDVGDIAAVIPHVNQPIYRHGDLTRNLYAALRIAGDWLTT
FT                   GELVERLTGHTYENCDRKLYERIRRSFRKRLTSLVSKGSVEREFSQGTTDCRQNHTRWR
FT                   LLSGRH"
     MTWRTPSSLK WLIVKHSRLQ GEIELLRREA EELDTQVVAQ RQRLERAEKN LLAIETSLGM        60
     HEVQVDVGDI AAVIPHVNQP IYRHGDLTRN LYAALRIAGD WLTTGELVER LTGHTYENCD       120
     RKLYERIRRS FRKRLTSLVS KGSVEREFSQ GTTDCRQNHT RWRLLSGRH                   169
//

If you have problems or comments...

PBIL Back to PBIL home page