(data stored in ACNUC9435 zone)

EMBL: AM039951.PE20

AM039951.PE20        Location/Qualifiers
FT   CDS             complement(23205..23723)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19832"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C084"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19832.1"
FT                   /translation="MMTNTQLNRIPSVELQLLTWLRLVKVGGIPNRVDLKRGGFRVQVH
FT                   PAIHNLDGFGRRVDVLNIAQVVANPRYEGRGWFTGFLELCDELNPWDATYVGSVVNPHL
FT                   PAFLRRQGFIEQQGAQFYRPSKAWRVHHSWSVECASSAQADADAARVEGLLDNFELETI
FT                   MVREAMLQR"
     MMTNTQLNRI PSVELQLLTW LRLVKVGGIP NRVDLKRGGF RVQVHPAIHN LDGFGRRVDV        60
     LNIAQVVANP RYEGRGWFTG FLELCDELNP WDATYVGSVV NPHLPAFLRR QGFIEQQGAQ       120
     FYRPSKAWRV HHSWSVECAS SAQADADAAR VEGLLDNFEL ETIMVREAML QR               172
//

If you have problems or comments...

PBIL Back to PBIL home page