(data stored in ACNUC9435 zone)

EMBL: AM039951.PE23

AM039951.PE23        Location/Qualifiers
FT   CDS             27131..27364
FT                   /transl_table=11
FT                   /locus_tag="XCVd0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0023"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19835"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C081"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19835.1"
FT                   /translation="MRKALSSSLPFLPQGSMYRIRSFHLTERERALFDRAVTGDEASPE
FT                   HETLQLLGFKDADLRAYSDLVRYLPRYVEAAI"
     MRKALSSSLP FLPQGSMYRI RSFHLTERER ALFDRAVTGD EASPEHETLQ LLGFKDADLR        60
     AYSDLVRYLP RYVEAAI                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page