(data stored in ACNUC9435 zone)

EMBL: AM039951.PE28

AM039951.PE28        Location/Qualifiers
FT   CDS             35189..35692
FT                   /transl_table=11
FT                   /locus_tag="XCVd0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19840"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C076"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19840.1"
FT                   /translation="MAALDLAPPKLVEFWRSYAPELGDLVSVMDRAENWTVDREPLLAD
FT                   RLVALGRRMTGPDQARAFVSADVPDLLLFLAYISTSTALRVIHWLDEQDEYQQYGSTVV
FT                   QRLLDAPGHLAGAIALSPLRDLLALRLRVISNTPYFTKLFAPERLAGLGAAITRYRQEA
FT                   VDVS"
     MAALDLAPPK LVEFWRSYAP ELGDLVSVMD RAENWTVDRE PLLADRLVAL GRRMTGPDQA        60
     RAFVSADVPD LLLFLAYIST STALRVIHWL DEQDEYQQYG STVVQRLLDA PGHLAGAIAL       120
     SPLRDLLALR LRVISNTPYF TKLFAPERLA GLGAAITRYR QEAVDVS                     167
//

If you have problems or comments...

PBIL Back to PBIL home page