(data stored in ACNUC9435 zone)

EMBL: AM039951.PE29

AM039951.PE29        Location/Qualifiers
FT   CDS             35682..36182
FT                   /transl_table=11
FT                   /locus_tag="XCVd0029"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19841"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C075"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19841.1"
FT                   /translation="MSRKIALAPLLGALLLTSGTASAIDAASVQAYCDQVRQSAQQAKQ
FT                   RHVQIFAPRQDPGKTFDDATQSCLDGIMSYKSMFQFKMPSLGDVQGILSQMAKEMLNKQ
FT                   CQAARAQFDRAVQDAVSTVNQSTNQLPGVDVDVSTGSGVTVKPKDGESTIWGSIVNKLG
FT                   GDK"
     MSRKIALAPL LGALLLTSGT ASAIDAASVQ AYCDQVRQSA QQAKQRHVQI FAPRQDPGKT        60
     FDDATQSCLD GIMSYKSMFQ FKMPSLGDVQ GILSQMAKEM LNKQCQAARA QFDRAVQDAV       120
     STVNQSTNQL PGVDVDVSTG SGVTVKPKDG ESTIWGSIVN KLGGDK                      166
//

If you have problems or comments...

PBIL Back to PBIL home page