(data stored in ACNUC9435 zone)

EMBL: AM039951.PE30

AM039951.PE30        Location/Qualifiers
FT   CDS             36182..37318
FT                   /transl_table=11
FT                   /locus_tag="XCVd0030"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19842"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C074"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19842.1"
FT                   /translation="MLLLRRFTALIFSLLVLGTSTLLIFSASTESTACCGDGVVAAAGA
FT                   EAAGASVVTAVGSATTSIITQLQLMDQNVSSGFGRLYEELAKQTAAQRTFEQGAISAQT
FT                   QMYMEERRAEAEEKYALSPRACFETASGVASTVAAGETKEAVNDLNRLMTDRTLNTPNT
FT                   AAAIGRIYKDHAEKYCSAQDAQLGRCTAVAAELQNADVRADVLLGSASLTPAQSDAAKA
FT                   LVANIVNPIPTQNIPTKWENTAQGRAFVSGQLLEQARTSVAANSLNQAVAARTRIPGLG
FT                   SAAMLNRADVSEREMMEAQVRGRFESPDWYKMLAAMSTENLLRELNKQSAFGLWMDYRE
FT                   FSQMERIESLLATDLAVTVKQDSEKRLQQARSAAAKAR"
     MLLLRRFTAL IFSLLVLGTS TLLIFSASTE STACCGDGVV AAAGAEAAGA SVVTAVGSAT        60
     TSIITQLQLM DQNVSSGFGR LYEELAKQTA AQRTFEQGAI SAQTQMYMEE RRAEAEEKYA       120
     LSPRACFETA SGVASTVAAG ETKEAVNDLN RLMTDRTLNT PNTAAAIGRI YKDHAEKYCS       180
     AQDAQLGRCT AVAAELQNAD VRADVLLGSA SLTPAQSDAA KALVANIVNP IPTQNIPTKW       240
     ENTAQGRAFV SGQLLEQART SVAANSLNQA VAARTRIPGL GSAAMLNRAD VSEREMMEAQ       300
     VRGRFESPDW YKMLAAMSTE NLLRELNKQS AFGLWMDYRE FSQMERIESL LATDLAVTVK       360
     QDSEKRLQQA RSAAAKAR                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page