(data stored in ACNUC9435 zone)

EMBL: AM039951.PE31

AM039951.PE31        Location/Qualifiers
FT   CDS             37318..38148
FT                   /transl_table=11
FT                   /locus_tag="XCVd0031"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19843"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C073"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19843.1"
FT                   /translation="MRPSKAAVIIGISGLLAALPYMKASAAYCCDPWGIPGKTAFAAAG
FT                   TSVVGAITAQVTAVSNYLQLYTSQTWSSGFAKTAEELSKQTAASRTFEQGRLAADTSLY
FT                   MTGVSGAAEEQAQEPALLDQTVTNAVLLSEQFNQQKNNRRRDDAGFAEYMRGDSHEDLV
FT                   SRGREFCDLRGKAAGFCDAIASSTLQNADISYNTISNPGDGQYETLTDAEARAARSFVR
FT                   NVVSATPMASTAGSTPQDEHHEALLLADQAVLSLAAHSLHSVMQNRVRKRENGQ"
     MRPSKAAVII GISGLLAALP YMKASAAYCC DPWGIPGKTA FAAAGTSVVG AITAQVTAVS        60
     NYLQLYTSQT WSSGFAKTAE ELSKQTAASR TFEQGRLAAD TSLYMTGVSG AAEEQAQEPA       120
     LLDQTVTNAV LLSEQFNQQK NNRRRDDAGF AEYMRGDSHE DLVSRGREFC DLRGKAAGFC       180
     DAIASSTLQN ADISYNTISN PGDGQYETLT DAEARAARSF VRNVVSATPM ASTAGSTPQD       240
     EHHEALLLAD QAVLSLAAHS LHSVMQNRVR KRENGQ                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page