(data stored in ACNUC9435 zone)

EMBL: AM039951.PE32

AM039951.PE32        Location/Qualifiers
FT   CDS             38145..38759
FT                   /transl_table=11
FT                   /locus_tag="XCVd0032"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19844"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C072"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19844.1"
FT                   /translation="MMIRALAFALLFIVSCGDAAQASAFDMADVIRDSAAKFAATQKVD
FT                   AGSAVKRMDDLLVRDYGARGRIASEHDPRLKSLYTQAARLLMNGNAISGGTLIVIASQE
FT                   SGYSGSKVGPALQAFIGAMLMPADEEDTVLRDFSERANRARSKLGVLRPELQMAAQLRV
FT                   MGAIYHDPIAVDAGVVALNKLSATADEEGAVAGALTAAGAK"
     MMIRALAFAL LFIVSCGDAA QASAFDMADV IRDSAAKFAA TQKVDAGSAV KRMDDLLVRD        60
     YGARGRIASE HDPRLKSLYT QAARLLMNGN AISGGTLIVI ASQESGYSGS KVGPALQAFI       120
     GAMLMPADEE DTVLRDFSER ANRARSKLGV LRPELQMAAQ LRVMGAIYHD PIAVDAGVVA       180
     LNKLSATADE EGAVAGALTA AGAK                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page