(data stored in ACNUC9435 zone)

EMBL: AM039951.PE34

AM039951.PE34        Location/Qualifiers
FT   CDS             39827..41131
FT                   /transl_table=11
FT                   /locus_tag="XCVd0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19846"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C070"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19846.1"
FT                   /translation="MSKLGALREKAVAEGAAVSSVEEEVPPLPPEAPMDAEFIAGLMAS
FT                   AAGAAGIPDRPPEAFPDVAVAPTVDGAPQGNQAPAGASSPPAGHAVPQGGEPHAVAPSA
FT                   PQAGMDTSDLLHALKGAIERLGPARTQAEVLAAPDAQGAWGEVRGLTAAALALGMASPV
FT                   EQLFRRYGAPGEGLLNAAQLKAPLNMAVAGFKPGAAPLAATQAKAAAAAAGQQAMGGPG
FT                   GGGGGGAGSVGAALAKLVAAPVTIPMAAGSRVWQMMQTRFGPRPKVQPGVDGFSVIRQQ
FT                   FDDAAGRAIDQIAHLRSGPMKSFLTEMAQDPLRPSEQLRRMQGDKKGTYFERAKQLREL
FT                   SAQPEVQGQYKKLNDAMEHLQYRSRRLAEYGHEAGMDVEDIIGDKLESVSKAGEGIPMT
FT                   DGKGKLAELRESLDALIERIREFLRTLFARPGASP"
     MSKLGALREK AVAEGAAVSS VEEEVPPLPP EAPMDAEFIA GLMASAAGAA GIPDRPPEAF        60
     PDVAVAPTVD GAPQGNQAPA GASSPPAGHA VPQGGEPHAV APSAPQAGMD TSDLLHALKG       120
     AIERLGPART QAEVLAAPDA QGAWGEVRGL TAAALALGMA SPVEQLFRRY GAPGEGLLNA       180
     AQLKAPLNMA VAGFKPGAAP LAATQAKAAA AAAGQQAMGG PGGGGGGGAG SVGAALAKLV       240
     AAPVTIPMAA GSRVWQMMQT RFGPRPKVQP GVDGFSVIRQ QFDDAAGRAI DQIAHLRSGP       300
     MKSFLTEMAQ DPLRPSEQLR RMQGDKKGTY FERAKQLREL SAQPEVQGQY KKLNDAMEHL       360
     QYRSRRLAEY GHEAGMDVED IIGDKLESVS KAGEGIPMTD GKGKLAELRE SLDALIERIR       420
     EFLRTLFARP GASP                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page