(data stored in ACNUC9435 zone)

EMBL: AM039951.PE35

AM039951.PE35        Location/Qualifiers
FT   CDS             41128..41364
FT                   /transl_table=11
FT                   /locus_tag="XCVd0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19847"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C069"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19847.1"
FT                   /translation="MRGSTLADYLGACDRYLSGHEQQFTSPWGLVLLAECAADAGLDLS
FT                   EADVSLDAALEQLAERVGLNRQDDLASLPAPGQ"
     MRGSTLADYL GACDRYLSGH EQQFTSPWGL VLLAECAADA GLDLSEADVS LDAALEQLAE        60
     RVGLNRQDDL ASLPAPGQ                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page