(data stored in ACNUC9435 zone)

EMBL: AM039951.PE37

AM039951.PE37        Location/Qualifiers
FT   CDS             43329..43754
FT                   /transl_table=11
FT                   /locus_tag="XCVd0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19849"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C067"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19849.1"
FT                   /translation="MRLVNIQSFDAASYREFEGIMLEFAKAQGWEFSFQAQPLPLASVF
FT                   NNATFGPALLVAAQVELSLRKIEVDLGLVVQEDNGAMFGRRVEFDPARSHLLTQMWRLT
FT                   QTAYQVDLLPREQNRIVLDLVPAALEPYEAPALQAGQ"
     MRLVNIQSFD AASYREFEGI MLEFAKAQGW EFSFQAQPLP LASVFNNATF GPALLVAAQV        60
     ELSLRKIEVD LGLVVQEDNG AMFGRRVEFD PARSHLLTQM WRLTQTAYQV DLLPREQNRI       120
     VLDLVPAALE PYEAPALQAG Q                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page