(data stored in ACNUC9435 zone)

EMBL: AM039951.PE38

AM039951.PE38        Location/Qualifiers
FT   CDS             43756..44811
FT                   /transl_table=11
FT                   /locus_tag="XCVd0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C066"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19850.1"
FT                   /translation="MGMIRRLMTASGEDAGSNAASEPIADLSPESMTAEVGRQDVGATT
FT                   NAAPSPQLPLEAEHGEAVIPPAPTPVNAPTGAQLTLSMLRAMGPIFRAALVYPGPTAPA
FT                   VEWAQAIKVMSDVSAQVAGQLALMRTEELDVAWARRELHPAVAVIVGEHWLHTVIKMQR
FT                   VQRVGDIKLNAEDILPGIVAALKASDDCGNPHLATERSAVAELLPAMALLQVNAQAYQA
FT                   LLQSDTVDLDVPDLSVDAYLQAVAAAVVDAVETQDARAKLSGALHGDEFREALLRSATG
FT                   IVVKAGETAVNESLARLHEAIKASAPARWLSEEPLQQGFPLARTVELIEQGINRLAGTA
FT                   VYIASKLGTKR"
     MGMIRRLMTA SGEDAGSNAA SEPIADLSPE SMTAEVGRQD VGATTNAAPS PQLPLEAEHG        60
     EAVIPPAPTP VNAPTGAQLT LSMLRAMGPI FRAALVYPGP TAPAVEWAQA IKVMSDVSAQ       120
     VAGQLALMRT EELDVAWARR ELHPAVAVIV GEHWLHTVIK MQRVQRVGDI KLNAEDILPG       180
     IVAALKASDD CGNPHLATER SAVAELLPAM ALLQVNAQAY QALLQSDTVD LDVPDLSVDA       240
     YLQAVAAAVV DAVETQDARA KLSGALHGDE FREALLRSAT GIVVKAGETA VNESLARLHE       300
     AIKASAPARW LSEEPLQQGF PLARTVELIE QGINRLAGTA VYIASKLGTK R                351
//

If you have problems or comments...

PBIL Back to PBIL home page