(data stored in ACNUC9435 zone)

EMBL: AM039951.PE39

AM039951.PE39        Location/Qualifiers
FT   CDS             44808..45305
FT                   /transl_table=11
FT                   /locus_tag="XCVd0039"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19851"
FT                   /db_xref="GOA:Q3C065"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C065"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19851.1"
FT                   /translation="MTEEVPAKKIQAPRVDVTPAPTRRRAIAGVARLARIVYLGDLGEI
FT                   RRTHAYFRDRLQRVLHQGRYARNETFEEAQARLGLTPQDVARRAAELRSQSLLYLGVAG
FT                   VALFVFLLLPLVSNPISHAVMSLLVMVLALSKYSVSRWRQGQCEERNLVPYMSYWLRWW
FT                   RS"
     MTEEVPAKKI QAPRVDVTPA PTRRRAIAGV ARLARIVYLG DLGEIRRTHA YFRDRLQRVL        60
     HQGRYARNET FEEAQARLGL TPQDVARRAA ELRSQSLLYL GVAGVALFVF LLLPLVSNPI       120
     SHAVMSLLVM VLALSKYSVS RWRQGQCEER NLVPYMSYWL RWWRS                       165
//

If you have problems or comments...

PBIL Back to PBIL home page