(data stored in ACNUC9435 zone)

EMBL: AM039951.PE4

AM039951.PE4         Location/Qualifiers
FT   CDS             complement(4890..6344)
FT                   /transl_table=11
FT                   /locus_tag="XCVd0004"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19816"
FT                   /db_xref="GOA:Q3C0A0"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C0A0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19816.1"
FT                   /translation="MYLCAAWLPPGSGLAWCYRAQTSPLMGSHPASDGDGSFFVSVRPA
FT                   PRGRQNAPSVVQAAAIRWRLDWRSQERYHAGYFLCGNVGSELIALPPNRVMTTSTRTEE
FT                   TEAQYRRRVEDLRKRVARIRGQNPADLLPMDLVDDLLGRGHGSEQAATDALAAFKRHRK
FT                   QSSAGERKSGVRMQGSAAEAAAAGVISKATFRQYKAALRAVFQADLETAPTRYDTELLS
FT                   AAIERLDSTPQTGYARKGRAGSALKSKSFKASELALVLREVHKGISESRHSWAVGLKTF
FT                   LEANSLVGLRPCEWAEASIRSGDDGMTVMVVRNAKTTNDRGNGSHRTLLLDDLTTQELG
FT                   ALHEMVELVDRVQSGQILDANGKAVSFDELLKHMRDYLRRLTRQIFPATGNRQHWPTLY
FT                   SLRHQVCADAKQSSTGSAESLRFVAALMGHKTDATATLHYGKRRGGSKGLRVRPSSENV
FT                   ATVEHRDPLSKFSPARDAPRRTKPSR"
     MYLCAAWLPP GSGLAWCYRA QTSPLMGSHP ASDGDGSFFV SVRPAPRGRQ NAPSVVQAAA        60
     IRWRLDWRSQ ERYHAGYFLC GNVGSELIAL PPNRVMTTST RTEETEAQYR RRVEDLRKRV       120
     ARIRGQNPAD LLPMDLVDDL LGRGHGSEQA ATDALAAFKR HRKQSSAGER KSGVRMQGSA       180
     AEAAAAGVIS KATFRQYKAA LRAVFQADLE TAPTRYDTEL LSAAIERLDS TPQTGYARKG       240
     RAGSALKSKS FKASELALVL REVHKGISES RHSWAVGLKT FLEANSLVGL RPCEWAEASI       300
     RSGDDGMTVM VVRNAKTTND RGNGSHRTLL LDDLTTQELG ALHEMVELVD RVQSGQILDA       360
     NGKAVSFDEL LKHMRDYLRR LTRQIFPATG NRQHWPTLYS LRHQVCADAK QSSTGSAESL       420
     RFVAALMGHK TDATATLHYG KRRGGSKGLR VRPSSENVAT VEHRDPLSKF SPARDAPRRT       480
     KPSR                                                                    484
//

If you have problems or comments...

PBIL Back to PBIL home page