(data stored in ACNUC9435 zone)

EMBL: AM039951.PE42

AM039951.PE42        Location/Qualifiers
FT   CDS             47114..47893
FT                   /transl_table=11
FT                   /locus_tag="XCVd0042"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19854"
FT                   /db_xref="GOA:Q3C062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C062"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19854.1"
FT                   /translation="MSKWKIKAVKVPASVARFIPVLGRCADWFERKLRRLYSSMRDRIS
FT                   PPVSVLVKKGRVTIAESVRAGGRVHILEVQPNRAHPLSTIQLQANVLQVGPSTILYADA
FT                   GLAALAYAQVRKAVLPATWSAWILRLVGLIAVVLILRLATVALLGSTAGNAAGGSKLEG
FT                   VSAQMAADPGFSPPSPAPQPLPGASELFGAAAPAGSGDLADQIYQQARAAAAKTEHATM
FT                   PPQPSVNVEGLAGFGLEEGGDQAGPGCDPNLAFKVEQ"
     MSKWKIKAVK VPASVARFIP VLGRCADWFE RKLRRLYSSM RDRISPPVSV LVKKGRVTIA        60
     ESVRAGGRVH ILEVQPNRAH PLSTIQLQAN VLQVGPSTIL YADAGLAALA YAQVRKAVLP       120
     ATWSAWILRL VGLIAVVLIL RLATVALLGS TAGNAAGGSK LEGVSAQMAA DPGFSPPSPA       180
     PQPLPGASEL FGAAAPAGSG DLADQIYQQA RAAAAKTEHA TMPPQPSVNV EGLAGFGLEE       240
     GGDQAGPGCD PNLAFKVEQ                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page