(data stored in ACNUC9435 zone)

EMBL: AM039951.PE44

AM039951.PE44        Location/Qualifiers
FT   CDS             50461..51081
FT                   /transl_table=11
FT                   /locus_tag="XCVd0044"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0044"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19856"
FT                   /db_xref="GOA:Q3C060"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C060"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19856.1"
FT                   /translation="MSFELTSLRRRNLLRSIASGIAAMGTGAVLSPAFARSGFVMPYGH
FT                   ADAYTSATFWAQPRVLRLHRPASNETVDACYWRDGQLDSAGYIRICRLLRDVQAGQAAT
FT                   IDMRLLNLLRGMQGWVEASYGIRDPYQVNSGYRTQATNKSTEGAARHSLHMKGQAVDGL
FT                   HPGLPLEYTGNLFKAFQGGGVGFYLNSKKFIHADVGSVRQWRG"
     MSFELTSLRR RNLLRSIASG IAAMGTGAVL SPAFARSGFV MPYGHADAYT SATFWAQPRV        60
     LRLHRPASNE TVDACYWRDG QLDSAGYIRI CRLLRDVQAG QAATIDMRLL NLLRGMQGWV       120
     EASYGIRDPY QVNSGYRTQA TNKSTEGAAR HSLHMKGQAV DGLHPGLPLE YTGNLFKAFQ       180
     GGGVGFYLNS KKFIHADVGS VRQWRG                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page