(data stored in ACNUC9435 zone)

EMBL: AM039951.PE45

AM039951.PE45        Location/Qualifiers
FT   CDS             51069..51857
FT                   /transl_table=11
FT                   /locus_tag="XCVd0045"
FT                   /product="putative periplasmic thiol:disulfide interchange
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19857"
FT                   /db_xref="GOA:Q3C059"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C059"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19857.1"
FT                   /translation="MARLINAAVGIALLLTSAVVQNAQASEAPKPTLAERHLMASGVKV
FT                   THRFDSVSGLRAIVADNGADKRLFYVTPDGKSLIAGLVFDESGRNVTTEDMGRAGISAS
FT                   GNTTAVTQLQAQKLWQRVQGLKALKDGNRGADIYVFVDPTCQYCHRLMSMVRPYIAAGT
FT                   LQVRWLPVAILSSRSPGLAEAMYKAPNVAQAIQSVSTNMLKPVPESEAIRLQLAQNLLA
FT                   MRDTGQTGVPLVVYRVGQRVVIKSGVPTDAELVALAGGAK"
     MARLINAAVG IALLLTSAVV QNAQASEAPK PTLAERHLMA SGVKVTHRFD SVSGLRAIVA        60
     DNGADKRLFY VTPDGKSLIA GLVFDESGRN VTTEDMGRAG ISASGNTTAV TQLQAQKLWQ       120
     RVQGLKALKD GNRGADIYVF VDPTCQYCHR LMSMVRPYIA AGTLQVRWLP VAILSSRSPG       180
     LAEAMYKAPN VAQAIQSVST NMLKPVPESE AIRLQLAQNL LAMRDTGQTG VPLVVYRVGQ       240
     RVVIKSGVPT DAELVALAGG AK                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page