(data stored in ACNUC9435 zone)

EMBL: AM039951.PE47

AM039951.PE47        Location/Qualifiers
FT   CDS             52552..53637
FT                   /transl_table=11
FT                   /locus_tag="XCVd0047"
FT                   /product="putative antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19859"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C057"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19859.1"
FT                   /translation="MGLLRTLRGSLAVPTPQAAAPAASSHVSGLSPASRPVYDRAAEGT
FT                   GIFVKHIEDGGCPWQQPQSKPLEWPRNELRGTPYHGFNAIALAMSGYDDPRWCTFDQAA
FT                   AKGWRVRAGEKATSIFMWKVQEKETGTYDDDGEPITRKFPLLCRFKIFNFAQISGPEPH
FT                   QPHQLTDTEARKLAEPIVETVGMTVTESATGPTGYNPERDSLVVRPRVAYPSEKHYCAD
FT                   LMNGVLAVAAREAVIGLALPAEAEMTDHQRAQRDLRVEIARSMLAMRTGLPLSPPAAVK
FT                   DAAILTLLQSDRREVFRAAKDAENIMRYALAFNPEVLPTLEDEHREQMSAAVAEGAPEM
FT                   VFDPSEFQFWPAELQQDRPRP"
     MGLLRTLRGS LAVPTPQAAA PAASSHVSGL SPASRPVYDR AAEGTGIFVK HIEDGGCPWQ        60
     QPQSKPLEWP RNELRGTPYH GFNAIALAMS GYDDPRWCTF DQAAAKGWRV RAGEKATSIF       120
     MWKVQEKETG TYDDDGEPIT RKFPLLCRFK IFNFAQISGP EPHQPHQLTD TEARKLAEPI       180
     VETVGMTVTE SATGPTGYNP ERDSLVVRPR VAYPSEKHYC ADLMNGVLAV AAREAVIGLA       240
     LPAEAEMTDH QRAQRDLRVE IARSMLAMRT GLPLSPPAAV KDAAILTLLQ SDRREVFRAA       300
     KDAENIMRYA LAFNPEVLPT LEDEHREQMS AAVAEGAPEM VFDPSEFQFW PAELQQDRPR       360
     P                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page