(data stored in ACNUC9435 zone)

EMBL: AM039951.PE48

AM039951.PE48        Location/Qualifiers
FT   CDS             53668..54459
FT                   /transl_table=11
FT                   /locus_tag="XCVd0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19860"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C056"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19860.1"
FT                   /translation="MPVTSMSDQLRALSVVASERSVGEIVQNLHKMWESVGRLVPERAT
FT                   VGDRVLFRLAKALFQDKIVVAEGLPEDDLVCEQYDQLQRRYLLSDVEGRRSLVSAIRHQ
FT                   HLMQPVHESEEVMPQTALVRVSGAAYVPITLRVMLPPVSLEAHRQELRLNFVQGTERTF
FT                   GFLPMVDVLEYRKRTHSLVALAPLHRWSRNPGQAVQVTYGDWFCADGYGRALYAAAVSG
FT                   LVVRRGESANGMGGVSPMFALTRAGRRAQLATEPAWSCKCL"
     MPVTSMSDQL RALSVVASER SVGEIVQNLH KMWESVGRLV PERATVGDRV LFRLAKALFQ        60
     DKIVVAEGLP EDDLVCEQYD QLQRRYLLSD VEGRRSLVSA IRHQHLMQPV HESEEVMPQT       120
     ALVRVSGAAY VPITLRVMLP PVSLEAHRQE LRLNFVQGTE RTFGFLPMVD VLEYRKRTHS       180
     LVALAPLHRW SRNPGQAVQV TYGDWFCADG YGRALYAAAV SGLVVRRGES ANGMGGVSPM       240
     FALTRAGRRA QLATEPAWSC KCL                                               263
//

If you have problems or comments...

PBIL Back to PBIL home page