(data stored in ACNUC9435 zone)

EMBL: AM039951.PE50

AM039951.PE50        Location/Qualifiers
FT   CDS             56639..57292
FT                   /transl_table=11
FT                   /locus_tag="XCVd0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19862"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C054"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19862.1"
FT                   /translation="MPLNPKHEIYIVGVNVDRYVVYRGSKSKDANSEPAVVKICQGVYM
FT                   QNGLDAESVFNRYGLRIAHYLTPSATISFSTAWHKAPKIGRVFVTGQYQYVRPLFGASD
FT                   RYNIVQSVGKVEPDNPKLHTMETFRDPLGEFTMLCDTPELTLLNMMTATKRHSEKHLNS
FT                   EEMDELLGHLMKEHGGKAGVASALEEVAVMAERTNELRRLIGLLYSPGKSFVSS"
     MPLNPKHEIY IVGVNVDRYV VYRGSKSKDA NSEPAVVKIC QGVYMQNGLD AESVFNRYGL        60
     RIAHYLTPSA TISFSTAWHK APKIGRVFVT GQYQYVRPLF GASDRYNIVQ SVGKVEPDNP       120
     KLHTMETFRD PLGEFTMLCD TPELTLLNMM TATKRHSEKH LNSEEMDELL GHLMKEHGGK       180
     AGVASALEEV AVMAERTNEL RRLIGLLYSP GKSFVSS                                217
//

If you have problems or comments...

PBIL Back to PBIL home page