(data stored in ACNUC9435 zone)

EMBL: AM039951.PE51

AM039951.PE51        Location/Qualifiers
FT   CDS             57295..58281
FT                   /transl_table=11
FT                   /locus_tag="XCVd0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19863"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C053"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19863.1"
FT                   /translation="MANWVDLAEHDLVLLWRPKPGCPHARQMILQTVTSGGSIPPDVVE
FT                   LGFLPEGKQYVRDSTVLLPDEFLQIFPRARMIDVPRDFFEHKHGSNIVHLAGRPAPDLA
FT                   ERVSSPHTAVDVGLMRWALTPRPRFILEARTLIEDGASVVSFGGMERLTRKRATSASLK
FT                   SLMHSLAVRAARDAGAQLPFQVMVDYPDYVYFGGARRTHAAYRANSLVARLSVAERLTR
FT                   GASATVVSTHTGVPDLVLRIQQANGQAELVVAQTSVGAVGLAGVAAGFEITRGRLHLAW
FT                   TSQAQQRGFDPLLASLFLSSLLSGGYEADNVRWDRPVLGPERSTAAA"
     MANWVDLAEH DLVLLWRPKP GCPHARQMIL QTVTSGGSIP PDVVELGFLP EGKQYVRDST        60
     VLLPDEFLQI FPRARMIDVP RDFFEHKHGS NIVHLAGRPA PDLAERVSSP HTAVDVGLMR       120
     WALTPRPRFI LEARTLIEDG ASVVSFGGME RLTRKRATSA SLKSLMHSLA VRAARDAGAQ       180
     LPFQVMVDYP DYVYFGGARR THAAYRANSL VARLSVAERL TRGASATVVS THTGVPDLVL       240
     RIQQANGQAE LVVAQTSVGA VGLAGVAAGF EITRGRLHLA WTSQAQQRGF DPLLASLFLS       300
     SLLSGGYEAD NVRWDRPVLG PERSTAAA                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page