(data stored in ACNUC9435 zone)

EMBL: AM039951.PE52

AM039951.PE52        Location/Qualifiers
FT   CDS             58342..61245
FT                   /transl_table=11
FT                   /locus_tag="XCVd0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XCVd0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAJ19864"
FT                   /db_xref="UniProtKB/TrEMBL:Q3C052"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="CAJ19864.1"
FT                   /translation="MPQWIDTQADGVALLARTSVSGAKELVLRRIRPDTVVPDAALTYG
FT                   FEPEGEIFVRKDTRFSLTEIRRIFPSAQVADMALEDIVYRVAAPIARLAVPKSARSAEV
FT                   LTPAADLLDVETPAAPSSWAQVPRGRFLMSARSLVDGGVPVVEFEGISHASPQSPKAVH
FT                   EQAVLAAVNAGESLPFAVLVDYPQIAYFGATKRHASTRVAKLLSSLEITERLLEGERAH
FT                   AVLKNDGFDDLVIVREARPEGQRLSLTHYYDKNGQITLDAELVFHIRGGQLHLSETAVE
FT                   NVLRGGEIRSYDAFLANRLAKNWLDQGFAVAEVHWPNQSVPSVVRAVPVSPEMPPTVDA
FT                   PSVAKVAAGPAAGMSMAFVFDSAGAAKLAVGMSQGAALGNLLAECASPSATNSSRSRIG
FT                   QNLSGMLLLEDANGVRYLELRSEEIAEDLSDRGVEHMTISEAQRAGKLTLAQKEPVKGV
FT                   LLFGRPVYRALKLADGSDAFFAIERGAAGESYAYKLDFADGGRPRWLSLGAAWTHGAPS
FT                   DGELMSSRPRPIDAFDQQAFVHEINQAIAVTSQDVLNERYRMLPLDADRITVRKISEQA
FT                   YEFSSADDWLPFGEVRVEQSGDHWRASHGTTSSSLRCSLEAACSWANRTIATQREHYLA
FT                   HLNQTTDGSLQFAIPEQDFTVLRRVLHKASIGEQTSWQGMGIHGDWTVYPKDLRAEIID
FT                   DRKLRIAVRGRELIYEICSMEADPASTYAHYQTEGLRRIGQWLGQVQDDIRWDETVRAH
FT                   PEGGLLKQRMREYQDLQVKHYGAAKFSARVPSTRAREMVLAITDRDVDRLISVIGDNGP
FT                   NNKSTMRLFQSVSGLRPGHSRTTRAEAVYRFCGYSDEQAAQHARRREDLARVRSMEREA
FT                   KARIEAAANMKVSHNGTEKTGKVMIDDVWAQGYTELSTRRQGASTRYMLRNPTTGQYYD
FT                   LKEPLTGYARHLVTIKDSANFVPGPSDEPEDVHTPGY"
     MPQWIDTQAD GVALLARTSV SGAKELVLRR IRPDTVVPDA ALTYGFEPEG EIFVRKDTRF        60
     SLTEIRRIFP SAQVADMALE DIVYRVAAPI ARLAVPKSAR SAEVLTPAAD LLDVETPAAP       120
     SSWAQVPRGR FLMSARSLVD GGVPVVEFEG ISHASPQSPK AVHEQAVLAA VNAGESLPFA       180
     VLVDYPQIAY FGATKRHAST RVAKLLSSLE ITERLLEGER AHAVLKNDGF DDLVIVREAR       240
     PEGQRLSLTH YYDKNGQITL DAELVFHIRG GQLHLSETAV ENVLRGGEIR SYDAFLANRL       300
     AKNWLDQGFA VAEVHWPNQS VPSVVRAVPV SPEMPPTVDA PSVAKVAAGP AAGMSMAFVF       360
     DSAGAAKLAV GMSQGAALGN LLAECASPSA TNSSRSRIGQ NLSGMLLLED ANGVRYLELR       420
     SEEIAEDLSD RGVEHMTISE AQRAGKLTLA QKEPVKGVLL FGRPVYRALK LADGSDAFFA       480
     IERGAAGESY AYKLDFADGG RPRWLSLGAA WTHGAPSDGE LMSSRPRPID AFDQQAFVHE       540
     INQAIAVTSQ DVLNERYRML PLDADRITVR KISEQAYEFS SADDWLPFGE VRVEQSGDHW       600
     RASHGTTSSS LRCSLEAACS WANRTIATQR EHYLAHLNQT TDGSLQFAIP EQDFTVLRRV       660
     LHKASIGEQT SWQGMGIHGD WTVYPKDLRA EIIDDRKLRI AVRGRELIYE ICSMEADPAS       720
     TYAHYQTEGL RRIGQWLGQV QDDIRWDETV RAHPEGGLLK QRMREYQDLQ VKHYGAAKFS       780
     ARVPSTRARE MVLAITDRDV DRLISVIGDN GPNNKSTMRL FQSVSGLRPG HSRTTRAEAV       840
     YRFCGYSDEQ AAQHARRRED LARVRSMERE AKARIEAAAN MKVSHNGTEK TGKVMIDDVW       900
     AQGYTELSTR RQGASTRYML RNPTTGQYYD LKEPLTGYAR HLVTIKDSAN FVPGPSDEPE       960
     DVHTPGY                                                                 967
//

If you have problems or comments...

PBIL Back to PBIL home page